PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG076000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 446aa    MW: 48265.2 Da    PI: 5.4253
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG076000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.8e-1955101148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg+WT+eEde l+  v+ +G + W++Iar+++ gR +kqc++rw ++l
  Pavir.9KG076000.1.p  55 RGPWTEEEDEMLKAMVEVYGDRKWAAIARHLP-GRIGKQCRERWTNHL 101
                          89******************************.************996 PP

2Myb_DNA-binding53.45.9e-17152194145
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          ++ WT+e+d  l++a+k +G++ W+ Iart+  gR+++++k++w+
  Pavir.9KG076000.1.p 152 KNTWTEEDDMNLIEAHKVHGNR-WSMIARTLE-GRSENSVKNHWN 194
                          679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.42750105IPR017930Myb domain
SMARTSM007175.4E-1954103IPR001005SANT/Myb domain
SuperFamilySSF466893.15E-2854102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2355103IPR009057Homeodomain-like
PfamPF002492.2E-1755101IPR001005SANT/Myb domain
CDDcd001679.03E-1757101No hitNo description
PROSITE profilePS5129417.675150201IPR017930Myb domain
SMARTSM007174.4E-14151199IPR001005SANT/Myb domain
PfamPF002492.1E-13152194IPR001005SANT/Myb domain
SuperFamilySSF466893.15E-28153193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-15154195IPR009057Homeodomain-like
CDDcd001672.33E-11154197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MLAPGGNIVQ PEGYLAPAPS SLHAAWNGVA AAAGGQQQHL PAGAGSGVLR LPPVRGPWTE  60
EEDEMLKAMV EVYGDRKWAA IARHLPGRIG KQCRERWTNH LRPEIDKYAE LEEKILLDLK  120
LQQLVLCTNM PDLADLWWIL LYVAKSCLLQ AKNTWTEEDD MNLIEAHKVH GNRWSMIART  180
LEGRSENSVK NHWNATKRSL KAKRRLKKKK NAEAPPGQQW SILEEYIRSL RPDELAAAPP  240
APSDDSPPSS YNVGYDGEVV SPPAAPAPAP GGGFDPAALR LYLSAAAAGN SSSAVNNQLA  300
AMNPNMAAPP PYLGLDLNAY YYGAPLQQQA PPQMMMMMSQ YQQQAAADNR STYPFVDHLA  360
WHSPVPNADA YATSSNANAA AGQHYYYNYN SDAGAGPSPA PAPAPAPTAT AANPEDDVDV  420
VQMASREFQL NTSDEEVTLN LAGFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-33541966103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986358.13e-95PREDICTED: transcription factor MYB98-like
TrEMBLK4ALU71e-117K4ALU7_SETIT; Uncharacterized protein
STRINGSi039882m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-31myb domain protein 98